Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein yaiZ (yaiZ)

This Recombinant Uncharacterized protein yaiZ (yaiZ) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

Uncharacterized protein yaiZ

UniProt

P0AAQ1

Expression Region

1-70

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLPVKIRRDWHYYAFAIGLIFILNGVVGLLGFEAKGWQTYAVGLVTWVISFWLAGLIIR RRDEETENAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNOC monoclonal antibody
MB67092-01 50 µL

PNOC monoclonal antibody

Sign In for Pricing
View Details
PNOC monoclonal antibody
MB67092-02 100 µL

PNOC monoclonal antibody

Sign In for Pricing
View Details
Human LTA-4 hydrolase Protein
orb1475785-01 50 µg

Human LTA-4 hydrolase Protein

Sign In for Pricing
View Details
Human LTA-4 hydrolase Protein
orb1475785-02 500 µg

Human LTA-4 hydrolase Protein

Sign In for Pricing
View Details
Restriction Enzyme Buffer (10X) for Ecl136II and SacI
R1625-55 1 mL

Restriction Enzyme Buffer (10X) for Ecl136II and SacI

Sign In for Pricing
View Details
GENLISA Human Receptor 2 For The Fc Region Of Immunoglobulin E (FcÎμRI) ELISA
KBH15487 1x 96 Well

GENLISA Human Receptor 2 For The Fc Region Of Immunoglobulin E (FcÎμRI) ELISA

Sign In for Pricing
View Details