Recombinant Caldicellulosiruptor saccharolyticus ATP synthase subunit c (atpE)
This Recombinant Caldicellulosiruptor saccharolyticus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.
Product Specifications
Product Name Alternative
ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein
UniProt
A4XKX5
Expression Region
1-70
Origin
Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MTALAAGIAMLAGLGVGIGIGIATAKAAESVGRQPEAYGRILPLFFIGAALAEAVAIYSF VIAILLVLKV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940031-100 1x 100 µL
Mucin 5AC (MUC5AC) (45M1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740225-500 1x 500 µL
Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040963-500 1x 500 µL
CD147 (BSG/963), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472010-500 1x 500 µL
NK1.1 / CD161c / Klrb1c, Mouse (PK136), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details