Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit c (atpE)

This Recombinant Staphylococcus aureus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A5IUQ3

Expression Region

1-70

Origin

Staphylococcus aureus (strain JH9)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIG VVIAFMTFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Glutaminyl-peptide cyclotransferase
MBS9420591-01 0.02 mg

Recombinant Human Glutaminyl-peptide cyclotransferase

Sign In for Pricing
View Details
Recombinant Human Glutaminyl-peptide cyclotransferase
MBS9420591-02 0.1 mg

Recombinant Human Glutaminyl-peptide cyclotransferase

Sign In for Pricing
View Details
Recombinant Human Glutaminyl-peptide cyclotransferase
MBS9420591-03 1 mg

Recombinant Human Glutaminyl-peptide cyclotransferase

Sign In for Pricing
View Details
Recombinant Human Glutaminyl-peptide cyclotransferase
MBS9420591-04 5x 1 mg

Recombinant Human Glutaminyl-peptide cyclotransferase

Sign In for Pricing
View Details
STAB1 Antibody
orb255657 100 µL

STAB1 Antibody

Sign In for Pricing
View Details
Fbxl17 3'UTR Luciferase Stable Cell Line
TU106396 1.0 mL

Fbxl17 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details