Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit c (atpE)

This Recombinant Staphylococcus aureus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A6U3J3

Expression Region

1-70

Origin

Staphylococcus aureus (strain JH1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIG VVIAFMTFAG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Histone H2A.Z Antibody (RM215) - Azide and BSA Free
NBP3-26045 100 µg

Rabbit Monoclonal Histone H2A.Z Antibody (RM215) - Azide and BSA Free

Sign In for Pricing
View Details
CD200R discontinued
590051 200 µg

CD200R discontinued

Sign In for Pricing
View Details
SP1 Recombinant Antibody
bsm-61380R-01 20 µL

SP1 Recombinant Antibody

Sign In for Pricing
View Details
SP1 Recombinant Antibody
bsm-61380R-02 100 µL

SP1 Recombinant Antibody

Sign In for Pricing
View Details
Recombinant Bovine F9 Protein, N-His
bs-106575P-01 20 µg

Recombinant Bovine F9 Protein, N-His

Sign In for Pricing
View Details
Recombinant Bovine F9 Protein, N-His
bs-106575P-02 50 µg

Recombinant Bovine F9 Protein, N-His

Sign In for Pricing
View Details