Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit c (atpE)

This Recombinant Staphylococcus aureus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A6QIV2

Expression Region

1-70

Origin

Staphylococcus aureus (strain Newman)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIG VVIAFMTFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Immortalized Human Bladder Smooth Muscle Cells
ABI-TC039R 1 Vial

Immortalized Human Bladder Smooth Muscle Cells

Sign In for Pricing
View Details
Multi-Drug 2-17 Drugs Rapid Test Cassette
DOA-1X5 (X:2-17) 25 Tests

Multi-Drug 2-17 Drugs Rapid Test Cassette

Sign In for Pricing
View Details
Obp83b Antibody
orb805858 2 mg

Obp83b Antibody

Sign In for Pricing
View Details
Bad Antibody (Center)
orb1936895-01 50 µL

Bad Antibody (Center)

Sign In for Pricing
View Details
Bad Antibody (Center)
orb1936895-02 100 µL

Bad Antibody (Center)

Sign In for Pricing
View Details
Human Gzms (Gzms) ELISA Kit
YP-W100725-01 48 Tests

Human Gzms (Gzms) ELISA Kit

Sign In for Pricing
View Details