Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit c (atpE)

This Recombinant Staphylococcus aureus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A6QIV2

Expression Region

1-70

Origin

Staphylococcus aureus (strain Newman)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIG VVIAFMTFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caffeic Acid
TRC-C080000-1G 1 g

Caffeic Acid

Sign In for Pricing
View Details
1,2,3-Trichlorobenzene
TRC-T773805-25G 25 g

1,2,3-Trichlorobenzene

Sign In for Pricing
View Details
5alpha-Androstane
TRC-A637938-250MG 250 mg

5alpha-Androstane

Sign In for Pricing
View Details
Vitamin D2 beta-D-Glucuronide Sodium Salt
TRC-V676035-5MG 5 mg

Vitamin D2 beta-D-Glucuronide Sodium Salt

Sign In for Pricing
View Details
Recombinant Human PDCD4/H731 Protein (His Tag)
PKSH032866-01 10 µg

Recombinant Human PDCD4/H731 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human PDCD4/H731 Protein (His Tag)
PKSH032866-02 50 µg

Recombinant Human PDCD4/H731 Protein (His Tag)

Sign In for Pricing
View Details