Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus pumilus ATP synthase subunit c (atpE)

This Recombinant Bacillus pumilus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A8FIB7

Expression Region

1-70

Origin

Bacillus pumilus (strain SAFR-032)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLIAAAIAIGLGALGAGIGNGLIVSKTVEGIARQPEAGRELRTLMFIGVALVEALPIIA VVIAFLAFFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ufc1 Mouse Gene Knockout Kit (CRISPR)
KN518652 1 Kit

Ufc1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CLPP Recombinant Rabbit Monoclonal Antibody [JE40-00]
HA721503 100 µL

CLPP Recombinant Rabbit Monoclonal Antibody [JE40-00]

Sign In for Pricing
View Details
Recombinant Mouse BAFF R/TNFRSF13C Protein (His Tag)
PDMM100162-01 20 µg

Recombinant Mouse BAFF R/TNFRSF13C Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse BAFF R/TNFRSF13C Protein (His Tag)
PDMM100162-02 100 µg

Recombinant Mouse BAFF R/TNFRSF13C Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse BAFF R/TNFRSF13C Protein (His Tag)
PDMM100162-03 500 µg

Recombinant Mouse BAFF R/TNFRSF13C Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse BAFF R/TNFRSF13C Protein (His Tag)
PDMM100162-04 1 mg

Recombinant Mouse BAFF R/TNFRSF13C Protein (His Tag)

Sign In for Pricing
View Details