Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit c (atpE)

This Recombinant Staphylococcus aureus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A8YY75

Expression Region

1-70

Origin

Staphylococcus aureus (strain USA300 / TCH1516)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIG VVIAFMTFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS26P17 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV784352 1.0 µg DNA

RPS26P17 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Human Prolactin receptor (PRLR) ELISA Kit
orb1655271-01 48 Tests

Human Prolactin receptor (PRLR) ELISA Kit

Sign In for Pricing
View Details
Human Prolactin receptor (PRLR) ELISA Kit
orb1655271-02 96 Tests

Human Prolactin receptor (PRLR) ELISA Kit

Sign In for Pricing
View Details
Human Endothelial PAS domain-containing protein 1 ELISA Kit
MBS9428004-01 96 Tests

Human Endothelial PAS domain-containing protein 1 ELISA Kit

Sign In for Pricing
View Details
Human Endothelial PAS domain-containing protein 1 ELISA Kit
MBS9428004-02 5x 96 Tests

Human Endothelial PAS domain-containing protein 1 ELISA Kit

Sign In for Pricing
View Details
LDN193189
M10276-01 1 g

LDN193189

Sign In for Pricing
View Details