Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Exiguobacterium sibiricum ATP synthase subunit c (atpE)

This Recombinant Exiguobacterium sibiricum ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B1YEG1

Expression Region

1-70

Origin

Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELIATAIIIGLGALGAGIGNGLIVNGTVLGQARQPELKNELRQTMFIGIGLVEALPIIG VAVGFLLLNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Aggrecan Antibody
RC-16762-01 50 μL

Recombinant Aggrecan Antibody

Sign In for Pricing
View Details
Recombinant Aggrecan Antibody
RC-16762-02 100 µL

Recombinant Aggrecan Antibody

Sign In for Pricing
View Details
Recombinant Aggrecan Antibody
RC-16762-03 1 mL

Recombinant Aggrecan Antibody

Sign In for Pricing
View Details
NEDD9 Antibody
KC-1773-01 50 μL

NEDD9 Antibody

Sign In for Pricing
View Details
NEDD9 Antibody
KC-1773-02 100 µL

NEDD9 Antibody

Sign In for Pricing
View Details
NEDD9 Antibody
KC-1773-03 1 mL

NEDD9 Antibody

Sign In for Pricing
View Details