Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactobacillus fermentum ATP synthase subunit c (atpE)

This Recombinant Lactobacillus fermentum ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B2GAU0

Expression Region

1-70

Origin

Lactobacillus fermentum (strain NBRC 3956 / LMG 18251)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGAIAAGIAAGLAAVGAGVGNGLVIGHTLDGMARQPEMSGQLRGTMFLGVGLIEALPILS IVIAFLVMNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (MUC5AC/917), 0.2mg/mL
BNUB0917-100 1x 100 µL

Mucin 5AC (MUC5AC) (MUC5AC/917), 0.2mg/mL

Sign In for Pricing
View Details
Human GFOD1 activation kit by CRISPRa
GA110100 1 Kit

Human GFOD1 activation kit by CRISPRa

Sign In for Pricing
View Details
F8 Antibody
KC-659-01 50 μL

F8 Antibody

Sign In for Pricing
View Details
F8 Antibody
KC-659-02 100 µL

F8 Antibody

Sign In for Pricing
View Details
F8 Antibody
KC-659-03 1 mL

F8 Antibody

Sign In for Pricing
View Details
BICD1 (NM_001714) Human Over-expression Lysate
LC419784 20 µg

BICD1 (NM_001714) Human Over-expression Lysate

Sign In for Pricing
View Details