Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactobacillus casei ATP synthase subunit c (atpE)

This Recombinant Lactobacillus casei ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B3WDL3

Expression Region

1-70

Origin

Lactobacillus casei (strain BL23)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQFIAASIAAGIAAFGASIGNGMVISKTLEGMARQPEMAGTLRGTMFIGVGLIEAVPILS VVVAFMLMSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human S100B Monoclonal Antibody
ANT-36318-50ug 50 µg

Human S100B Monoclonal Antibody

Sign In for Pricing
View Details
NEU2 Rabbit Polyclonal Antibody (BF680)
orb2442391 100 µL

NEU2 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Drebrin Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-5835R-BF750-TR 20 µL

Drebrin Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
ACAT-2 Double Nickase Plasmid (m)
sc-431025-NIC 20 µg

ACAT-2 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Lrr1 (NM_001081406) Mouse Tagged ORF Clone
MR221259 10 µg

Lrr1 (NM_001081406) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Anti-SLFN11 Antibody Picoband®, APC Conjugate
A08259-APC 100 µg/Vial

Anti-SLFN11 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details