Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactobacillus casei ATP synthase subunit c (atpE)

This Recombinant Lactobacillus casei ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B3WDL3

Expression Region

1-70

Origin

Lactobacillus casei (strain BL23)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQFIAASIAAGIAAFGASIGNGMVISKTLEGMARQPEMAGTLRGTMFIGVGLIEAVPILS VVVAFMLMSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab11a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6981207 1.0 µg DNA

Rab11a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
ELAVL2 (NM_001171195) Human Over-expression Lysate
LY432918 100 µg

ELAVL2 (NM_001171195) Human Over-expression Lysate

Sign In for Pricing
View Details
4933403O08Rik (NM_001177389) Mouse Tagged Lenti ORF Clone
MR223456L3 10 µg

4933403O08Rik (NM_001177389) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
HBSS w/ Calcium w/ Magnesium w/ Sodium Bicarbonate w/ Phenol Red - 500ml
LM-S2035/500 500 mL

HBSS w/ Calcium w/ Magnesium w/ Sodium Bicarbonate w/ Phenol Red - 500ml

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Permeability Glycoprotein (Pgp)
MBS2113393-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Permeability Glycoprotein (Pgp)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Permeability Glycoprotein (Pgp)
MBS2113393-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Permeability Glycoprotein (Pgp)

Sign In for Pricing
View Details