Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactobacillus casei ATP synthase subunit c (atpE)

This Recombinant Lactobacillus casei ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B3WDL3

Expression Region

1-70

Origin

Lactobacillus casei (strain BL23)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQFIAASIAAGIAAFGASIGNGMVISKTLEGMARQPEMAGTLRGTMFIGVGLIEAVPILS VVVAFMLMSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DACT1 Pre-designed siRNA Set A
SI003966A 1 Each

Human DACT1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Human Amphiphysin/AMPH Protein - (Dry Ice)
H00000273-P01-10ug 10 µg

Recombinant Human Amphiphysin/AMPH Protein - (Dry Ice)

Sign In for Pricing
View Details
TMEM72 Protein Vector (Rat) (pPM-C-His)
PV311821 500 ng

TMEM72 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
TMPO Rabbit Polyclonal Antibody
E28PT5830 100 µL

TMPO Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Twist Antibody
E18-5224-1 50 µg - 50 µL

Twist Antibody

Sign In for Pricing
View Details
DVL1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0642307 1.0 µg DNA

DVL1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details