Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nostoc punctiforme NAD (P) H-quinone oxidoreductase subunit L

This Recombinant Nostoc punctiforme NAD (P) H-quinone oxidoreductase subunit L spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

NAD (P) H-quinone oxidoreductase subunit L, EC= 1.6.5.-, NAD (P) H dehydrogenase I subunit L, NDH-1 subunit L, NDH-L

UniProt

B2J0I9

Expression Region

1-70

Origin

Nostoc punctiforme (strain ATCC 29133 / PCC 73102)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIVALLYLILAGAYLLVIPIAVLFYLKQRWYVASSIERLLMYFLVFFFFPGLLVLSPFAN FRPQRRQVQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (RIV11), CF740 conjugate, 0.1mg/mL
BNC740333-500 1x 500 µL

CD8 (RIV11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL
BNC040270-100 1x 100 µL

Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL
BNC740031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL
BNC680008-500 1x 500 µL

MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF488A conjugate, 0.1mg/mL
BNC881820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (A53-B/A2.26 + BA17), CF594 conjugate, 0.1mg/mL
BNC940753-100 1x 100 µL

Cytokeratin 19 (A53-B/A2.26 + BA17), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details