Recombinant Anoxybacillus flavithermus ATP synthase subunit c (atpE)
This Recombinant Anoxybacillus flavithermus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.
Product Specifications
Product Name Alternative
ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein
UniProt
B7GMF8
Expression Region
1-70
Origin
Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MGVLAAAIAIGLAALGAGIGNGLIVSRTVEGIARQPEARGMLQTTMFIGVALVEAIPIIA VVIAFMVQGR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC551137-500 1x 500 µL
ZAP70 (ZAP70/528 + 2F3.2), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
LC401932 20 µg
PRA1 (RABAC1) (NM_006423) Human Over-expression Lysate
Sign In for Pricing
View Details 