Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anoxybacillus flavithermus ATP synthase subunit c (atpE)

This Recombinant Anoxybacillus flavithermus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B7GMF8

Expression Region

1-70

Origin

Anoxybacillus flavithermus (strain DSM 21510 / WK1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGVLAAAIAIGLAALGAGIGNGLIVSRTVEGIARQPEARGMLQTTMFIGVALVEAIPIIA VVIAFMVQGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDHB Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A3]
TA808201AM 100 µL

SDHB Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2A3]

Sign In for Pricing
View Details
PLA2R (PLA2R1) (NM_001007267) Human Over-expression Lysate
LY423477 100 µg

PLA2R (PLA2R1) (NM_001007267) Human Over-expression Lysate

Sign In for Pricing
View Details
OXSM Rabbit Polyclonal Antibody
TA366642 100 µL

OXSM Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mefenacet
TRC-M205600-5G 5 g

Mefenacet

Sign In for Pricing
View Details
NFKB1 pSer893 Rabbit Polyclonal Antibody
AP01645PU-N 100 µg

NFKB1 pSer893 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD71 (DF1513), 1mg/mL
BNUM0188-50 1x 50 µL

CD71 (DF1513), 1mg/mL

Sign In for Pricing
View Details