Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus carnosus ATP synthase subunit c (atpE)

This Recombinant Staphylococcus carnosus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B9DME9

Expression Region

1-70

Origin

Staphylococcus carnosus (strain TM300)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMSIMFIGIGLVEALPILG LVISFIVLFQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Keratin 36 Rabbit pAb, Pacific Blue conjugated
orb2848478 100 µL

Keratin 36 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Tmem47 ORF Vector (Mouse) (pORF)
ORF059931 1.0 µg DNA

Tmem47 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
SLC17A9 Recombinant Protein (Rat)
RP229025 100 µg

SLC17A9 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Human ZC3H6 Knockout A549 cell line
GTR15415415 1 Vial

Human ZC3H6 Knockout A549 cell line

Sign In for Pricing
View Details
Recombinant Kallikrein 2 (KLK2)
MBS2030243-01 0.01 mg

Recombinant Kallikrein 2 (KLK2)

Sign In for Pricing
View Details
Recombinant Kallikrein 2 (KLK2)
MBS2030243-02 0.05 mg

Recombinant Kallikrein 2 (KLK2)

Sign In for Pricing
View Details