Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus carnosus ATP synthase subunit c (atpE)

This Recombinant Staphylococcus carnosus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B9DME9

Expression Region

1-70

Origin

Staphylococcus carnosus (strain TM300)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMSIMFIGIGLVEALPILG LVISFIVLFQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Major acute phase proteins (MAP) ELISA Kit
MBS9302284-01 48 Well

Porcine Major acute phase proteins (MAP) ELISA Kit

Sign In for Pricing
View Details
Porcine Major acute phase proteins (MAP) ELISA Kit
MBS9302284-02 96 Well

Porcine Major acute phase proteins (MAP) ELISA Kit

Sign In for Pricing
View Details
Porcine Major acute phase proteins (MAP) ELISA Kit
MBS9302284-03 5x 96 Well

Porcine Major acute phase proteins (MAP) ELISA Kit

Sign In for Pricing
View Details
Porcine Major acute phase proteins (MAP) ELISA Kit
MBS9302284-04 10x 96 Well

Porcine Major acute phase proteins (MAP) ELISA Kit

Sign In for Pricing
View Details
ZC3H12D 3'UTR Luciferase Stable Cell Line
TU028760 1.0 mL

ZC3H12D 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human Lymph node Tumor (single section per slide)
HuCAT441 5 Slides/Pack

Human Lymph node Tumor (single section per slide)

Sign In for Pricing
View Details