Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pilin (traA)

This Recombinant Pilin (traA) spans the amino acid sequence from region 52-121.

Product Specifications

Product Name Alternative

Pilin

UniProt

B1VC86

Expression Region

52-121

Origin

Escherichia coli

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AGSSGQDLMASGNTTVKATFGKDSSVVKWVVLAEVLVGAVMYMMTKNVKFLAGFAIISVF IAVGMAVVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKR1A1 Antibody
orb1325188 100 µL

AKR1A1 Antibody

Sign In for Pricing
View Details
Fungus Chitinase Recombinant Protein
PX-P2067-100 100 µg

Fungus Chitinase Recombinant Protein

Sign In for Pricing
View Details
Rabbit ataxia telangiectasia-mutated gene (ATM) ELISA Kit
MBS2616277-01 48 Well

Rabbit ataxia telangiectasia-mutated gene (ATM) ELISA Kit

Sign In for Pricing
View Details
Rabbit ataxia telangiectasia-mutated gene (ATM) ELISA Kit
MBS2616277-02 96 Well

Rabbit ataxia telangiectasia-mutated gene (ATM) ELISA Kit

Sign In for Pricing
View Details
Rabbit ataxia telangiectasia-mutated gene (ATM) ELISA Kit
MBS2616277-03 5x 96 Well

Rabbit ataxia telangiectasia-mutated gene (ATM) ELISA Kit

Sign In for Pricing
View Details
Rabbit ataxia telangiectasia-mutated gene (ATM) ELISA Kit
MBS2616277-04 10x 96 Well

Rabbit ataxia telangiectasia-mutated gene (ATM) ELISA Kit

Sign In for Pricing
View Details