Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pilin (traA)

This Recombinant Pilin (traA) spans the amino acid sequence from region 52-121.

Product Specifications

Product Name Alternative

Pilin

UniProt

B1VC86

Expression Region

52-121

Origin

Escherichia coli

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AGSSGQDLMASGNTTVKATFGKDSSVVKWVVLAEVLVGAVMYMMTKNVKFLAGFAIISVF IAVGMAVVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TUBE RACK, Holds 15mL, Plastic Sample Tubes, 4 x 5 for 20 Total, (16.7mm OD), 6.4mm Thick Top and Bottom Plate, Connected with Stainless Steel Stand-offs, 80mm Overall Height, SLAS Footprint
VP 418-20-17-PLA 1 EACH

TUBE RACK, Holds 15mL, Plastic Sample Tubes, 4 x 5 for 20 Total, (16.7mm OD), 6.4mm Thick Top and Bottom Plate, Connected with Stainless Steel Stand-offs, 80mm Overall Height, SLAS Footprint

Sign In for Pricing
View Details
DKK3 Mouse mAb Antibody
orb3064299-01 50 µL

DKK3 Mouse mAb Antibody

Sign In for Pricing
View Details
DKK3 Mouse mAb Antibody
orb3064299-02 100 µL

DKK3 Mouse mAb Antibody

Sign In for Pricing
View Details
S100A14 Antibody
V4717SAF-100UG 100 µg

S100A14 Antibody

Sign In for Pricing
View Details
Chicken Testis-expressed sequence 10 protein (TEX10) ELISA Kit
MBS7235287-01 48 Well

Chicken Testis-expressed sequence 10 protein (TEX10) ELISA Kit

Sign In for Pricing
View Details
Chicken Testis-expressed sequence 10 protein (TEX10) ELISA Kit
MBS7235287-02 96 Well

Chicken Testis-expressed sequence 10 protein (TEX10) ELISA Kit

Sign In for Pricing
View Details