Recombinant Staphylococcus aureus ATP synthase subunit c (atpE)
This Recombinant Staphylococcus aureus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.
Product Specifications
Product Name Alternative
ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein
UniProt
Q2FF19
Expression Region
1-70
Origin
Staphylococcus aureus (strain USA300)
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIG VVIAFMTFAG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
C2432-01Q-APC 100 µL
CD80 (CD80 Antigen, CD80 Molecule, Activation B7-1 Antigen, B-lymphocyte Activation Antigen B7, B7, BB1, CD28 Antigen Ligand 1 B7-1 Antigen, CD28LG, CD28LG1, Costimulatory Factor CD80, CTLA-4 Counter-receptor B7.1, LAB7, T lymphocyte Activation Antigen CD80) (APC) discontinued
Sign In for Pricing
View Details 
NU-811-612Q 40 µL
8- (6-Aminohexyl) -amino-adenosine-3',5'-bisphosphate-ATTO-612Q
Sign In for Pricing
View Details