Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit c (atpE)

This Recombinant Staphylococcus aureus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q2FF19

Expression Region

1-70

Origin

Staphylococcus aureus (strain USA300)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIG VVIAFMTFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCC3 Protein Vector (Human) (pPB-His-GST)
PV318775 500 ng

ABCC3 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
CLSTN3 Protein Vector (Human) (pPB-N-His)
PV050858 500 ng

CLSTN3 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Human COL5A3 Knockout A549 cell line
GTR15408300 1 Vial

Human COL5A3 Knockout A549 cell line

Sign In for Pricing
View Details
Anti-TARC/CCL17 Antibody Picoband® Fluoro488 Conjugated
PB9031-Fluoro488 100 µg/Vial

Anti-TARC/CCL17 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Bovine Cartilage-associated protein (CRTAP) ELISA Kit
MBS7248995-01 48 Well

Bovine Cartilage-associated protein (CRTAP) ELISA Kit

Sign In for Pricing
View Details
Bovine Cartilage-associated protein (CRTAP) ELISA Kit
MBS7248995-02 96 Well

Bovine Cartilage-associated protein (CRTAP) ELISA Kit

Sign In for Pricing
View Details