Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit c (atpE)

This Recombinant Staphylococcus aureus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q2G2F6

Expression Region

1-70

Origin

Staphylococcus aureus (strain NCTC 8325)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIG VVIAFMTFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli (strain K12) GLGA Polyclonal Antibody
MBS7165026 Inquire

Rabbit anti-Escherichia coli (strain K12) GLGA Polyclonal Antibody

Sign In for Pricing
View Details
NPF2.7 Antibody
orb794799 2 mg

NPF2.7 Antibody

Sign In for Pricing
View Details
Human SIRT3 Protein Lysate 20ug
IHUSIRT3PLLY20UG 20 µg

Human SIRT3 Protein Lysate 20ug

Sign In for Pricing
View Details
HGF Antibody
F40371-0.4ML 0.4 mL

HGF Antibody

Sign In for Pricing
View Details
ZNF383, NT (ZNF383, Zinc finger protein 383) (MaxLight 750)
MBS6366413-01 0.1 mL

ZNF383, NT (ZNF383, Zinc finger protein 383) (MaxLight 750)

Sign In for Pricing
View Details
ZNF383, NT (ZNF383, Zinc finger protein 383) (MaxLight 750)
MBS6366413-02 5x 0.1 mL

ZNF383, NT (ZNF383, Zinc finger protein 383) (MaxLight 750)

Sign In for Pricing
View Details