Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit c (atpE)

This Recombinant Staphylococcus aureus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q2YUJ6

Expression Region

1-70

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIG VVIAFMTFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TACC2 Mouse Monoclonal Antibody [Clone:5H1]
E45M16408 100 µg

TACC2 Mouse Monoclonal Antibody [Clone:5H1]

Sign In for Pricing
View Details
(S) -1- ((S) -2- (3,4,5-Trimethoxyphenyl) butanoyl) piperidine-2-carboxylic acid
orb3144178-01 10 mg

(S) -1- ((S) -2- (3,4,5-Trimethoxyphenyl) butanoyl) piperidine-2-carboxylic acid

Sign In for Pricing
View Details
(S) -1- ((S) -2- (3,4,5-Trimethoxyphenyl) butanoyl) piperidine-2-carboxylic acid
orb3144178-02 50 mg

(S) -1- ((S) -2- (3,4,5-Trimethoxyphenyl) butanoyl) piperidine-2-carboxylic acid

Sign In for Pricing
View Details
Mouse Monoclonal anti-Human CD158a (KIR2DL1) Antibody
xAP-0125 100 µg

Mouse Monoclonal anti-Human CD158a (KIR2DL1) Antibody

Sign In for Pricing
View Details
Gkn1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7161406 1.0 µg DNA

Gkn1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
14-3-3 zeta (YWHAZ) (NM_001135700) Human Recombinant Protein
E45H33347M5 20 µg

14-3-3 zeta (YWHAZ) (NM_001135700) Human Recombinant Protein

Sign In for Pricing
View Details