Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit c (atpE)

This Recombinant Staphylococcus aureus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q2YUJ6

Expression Region

1-70

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIG VVIAFMTFAG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA Human 5-Methyltetrahydrofolate (5-MTHF) ELISA
KBH21644 1x 96 Well

GENLISA Human 5-Methyltetrahydrofolate (5-MTHF) ELISA

Sign In for Pricing
View Details
D3Bwg0562e sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
17596114 3x 1.0 µg

D3Bwg0562e sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
2'-5'-Oligoadenylate Synthase-Like Protein (OASL) Antibody
abx324997-01 50 µg

2'-5'-Oligoadenylate Synthase-Like Protein (OASL) Antibody

Sign In for Pricing
View Details
2'-5'-Oligoadenylate Synthase-Like Protein (OASL) Antibody
abx324997-02 100 µg

2'-5'-Oligoadenylate Synthase-Like Protein (OASL) Antibody

Sign In for Pricing
View Details
Aβ1-42 (CT) Rabbit Polyclonal Antibody (HRP)
orb526283 100 µL

Aβ1-42 (CT) Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Recombinant Caenorhabditis briggsae ATPase inhibitor mai-2, mitochondrial (mai-2), partial
MBS1218207 Inquire

Recombinant Caenorhabditis briggsae ATPase inhibitor mai-2, mitochondrial (mai-2), partial

Sign In for Pricing
View Details