Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactobacillus sakei subsp. sakei ATP synthase subunit c (atpE)

This Recombinant Lactobacillus sakei subsp. sakei ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q38WK0

Expression Region

1-70

Origin

Lactobacillus sakei subsp. sakei (strain 23K)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNFLAAAIAAGLAAFAASYGNGKVISKTIESMARQPELSAQLRSTMFIGVGLIEAVPILS IVVSFLILFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CELA3B (CELA3B/1218), CF740 conjugate, 0.1mg/mL
BNC741218-100 1x 100 µL

CELA3B (CELA3B/1218), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SynaptoGreenTMC5
#70046 1x 5 mg

SynaptoGreenTMC5

Sign In for Pricing
View Details
Tridecane
TRC-T078145-5G 5 g

Tridecane

Sign In for Pricing
View Details
(3Alpha,5Beta,11Beta)-Pregnane-3,11,17,20,21-pentol 21-Acetate
TRC-P705235-25MG 25 mg

(3Alpha,5Beta,11Beta)-Pregnane-3,11,17,20,21-pentol 21-Acetate

Sign In for Pricing
View Details
Cdc6 Mouse Gene Knockout Kit (CRISPR)
KN502986 1 Kit

Cdc6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NT5C1B (NT5C1B-RDH14) (NM_001199103) Human Over-expression Lysate
LC434354 20 µg

NT5C1B (NT5C1B-RDH14) (NM_001199103) Human Over-expression Lysate

Sign In for Pricing
View Details