Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactobacillus sakei subsp. sakei ATP synthase subunit c (atpE)

This Recombinant Lactobacillus sakei subsp. sakei ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q38WK0

Expression Region

1-70

Origin

Lactobacillus sakei subsp. sakei (strain 23K)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNFLAAAIAAGLAAFAASYGNGKVISKTIESMARQPELSAQLRSTMFIGVGLIEAVPILS IVVSFLILFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Chloropropyl Acetate
TRC-C327210-25G 25 g

3-Chloropropyl Acetate

Sign In for Pricing
View Details
Human TMEM198 activation kit by CRISPRa
GA115122 1 Kit

Human TMEM198 activation kit by CRISPRa

Sign In for Pricing
View Details
SAPK4 (MAPK13) Human Gene Knockout Kit (CRISPR)
KN400606 1 Kit

SAPK4 (MAPK13) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dinitrodenafil
TRC-D479775-1G 1 g

Dinitrodenafil

Sign In for Pricing
View Details
Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Human IgA,  5nm
GAF-351-5 1 mL

Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Human IgA, 5nm

Sign In for Pricing
View Details
Carbamyl Benzyl Ester
TRC-C176035-25G 25 g

Carbamyl Benzyl Ester

Sign In for Pricing
View Details