Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis ATP synthase subunit c (atpE)

This Recombinant Staphylococcus epidermidis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q5HMB4

Expression Region

1-70

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIG VVIAFMTFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Hnrnpk shRNA (UAS) - Lentiviral mouse Hnrnpk shRNA (UAS, GFP) (100)
GTR15213861 1 Vial

Lentiviral mouse Hnrnpk shRNA (UAS) - Lentiviral mouse Hnrnpk shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Mouse Arginine Vasopressin Receptor 1B (AVPR1B) ELISA Kit
DL-AVPR1B-Mu-01 48 Tests

Mouse Arginine Vasopressin Receptor 1B (AVPR1B) ELISA Kit

Sign In for Pricing
View Details
Mouse Arginine Vasopressin Receptor 1B (AVPR1B) ELISA Kit
DL-AVPR1B-Mu-02 96 Tests

Mouse Arginine Vasopressin Receptor 1B (AVPR1B) ELISA Kit

Sign In for Pricing
View Details
Anti-Human LSP1 Nanobody
MBS1568085-01 0.1 mg

Anti-Human LSP1 Nanobody

Sign In for Pricing
View Details
Anti-Human LSP1 Nanobody
MBS1568085-02 1 mg

Anti-Human LSP1 Nanobody

Sign In for Pricing
View Details
Anti-Human LSP1 Nanobody
MBS1568085-03 5x 1 mg

Anti-Human LSP1 Nanobody

Sign In for Pricing
View Details