Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis ATP synthase subunit c (atpE)

This Recombinant Staphylococcus epidermidis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q5HMB4

Expression Region

1-70

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIG VVIAFMTFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neu5Acα (2-3) Galβ MP glycoside
orb2942002-01 10 mg

Neu5Acα (2-3) Galβ MP glycoside

Sign In for Pricing
View Details
Neu5Acα (2-3) Galβ MP glycoside
orb2942002-02 50 mg

Neu5Acα (2-3) Galβ MP glycoside

Sign In for Pricing
View Details
Neu5Acα (2-3) Galβ MP glycoside
orb2942002-03 100 mg

Neu5Acα (2-3) Galβ MP glycoside

Sign In for Pricing
View Details
Recombinant Oceanobacillus iheyensis Membrane protein insertase YidC (yidC)
orb2917557-01 20 µg

Recombinant Oceanobacillus iheyensis Membrane protein insertase YidC (yidC)

Sign In for Pricing
View Details
Recombinant Oceanobacillus iheyensis Membrane protein insertase YidC (yidC)
orb2917557-02 100 µg

Recombinant Oceanobacillus iheyensis Membrane protein insertase YidC (yidC)

Sign In for Pricing
View Details
Kinesin-like Protein KIF1C (Phospho-Ser1092) Antibody
12459-01 50 µL

Kinesin-like Protein KIF1C (Phospho-Ser1092) Antibody

Sign In for Pricing
View Details