Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis ATP synthase subunit c (atpE)

This Recombinant Staphylococcus epidermidis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q5HMB4

Expression Region

1-70

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIG VVIAFMTFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MYL6B sgRNA CRISPR Lentivector (Human) (Target 2)
K1375903 1.0 µg DNA

MYL6B sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
LARP4 siRNA (Human)
MBS8226273-01 15 nmol

LARP4 siRNA (Human)

Sign In for Pricing
View Details
LARP4 siRNA (Human)
MBS8226273-02 30 nmol

LARP4 siRNA (Human)

Sign In for Pricing
View Details
LARP4 siRNA (Human)
MBS8226273-03 5x 30 nmol

LARP4 siRNA (Human)

Sign In for Pricing
View Details
Lysophosphatidic Acid (LPA) ELISA Kit
EKN49865 96 Tests

Lysophosphatidic Acid (LPA) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal HOMER1 Antibody (2F7) [Alexa Fluor 405]
NBP2-50605AF405 0.1 mL

Mouse Monoclonal HOMER1 Antibody (2F7) [Alexa Fluor 405]

Sign In for Pricing
View Details