Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus licheniformis ATP synthase subunit c (atpE)

This Recombinant Bacillus licheniformis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q65DW9

Expression Region

1-70

Origin

Bacillus licheniformis (strain DSM 13 / ATCC 14580)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLIAAAIAIGLGALGAGIGNGLIVSRTVEGIARQPEAGKELRTLMFIGVALVEALPIIA VVIAFLAFFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 647 succinimidyl ester
71031-AAT 100 µg

IFluor® 647 succinimidyl ester

Sign In for Pricing
View Details
PPP2R1B Mouse Monoclonal Antibody [Clone ID: OTI8C5]
CF811459 100 µg

PPP2R1B Mouse Monoclonal Antibody [Clone ID: OTI8C5]

Sign In for Pricing
View Details
DDR2 Human Gene Knockout Kit (CRISPR)
KN208745BN 1 Kit

DDR2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rsf1 Mouse Gene Knockout Kit (CRISPR)
KN515158 1 Kit

Rsf1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PMA Real-Time PCR Bacterial Viability Kit - Listeria monocytogenes (hly)
#31051 1 Kit

PMA Real-Time PCR Bacterial Viability Kit - Listeria monocytogenes (hly)

Sign In for Pricing
View Details
VPS41 Human Gene Knockout Kit (CRISPR)
KN207267LP 1 Kit

VPS41 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details