Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus licheniformis ATP synthase subunit c (atpE)

This Recombinant Bacillus licheniformis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q65DW9

Expression Region

1-70

Origin

Bacillus licheniformis (strain DSM 13 / ATCC 14580)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLIAAAIAIGLGALGAGIGNGLIVSRTVEGIARQPEAGKELRTLMFIGVALVEALPIIA VVIAFLAFFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPATA46 Mouse Monoclonal Antibody [Clone ID: OTI1A9]
CF811093 100 µg

SPATA46 Mouse Monoclonal Antibody [Clone ID: OTI1A9]

Sign In for Pricing
View Details
CD10 Antibody
KC-28649-01 50 μL

CD10 Antibody

Sign In for Pricing
View Details
CD10 Antibody
KC-28649-02 100 µL

CD10 Antibody

Sign In for Pricing
View Details
CD10 Antibody
KC-28649-03 1 mL

CD10 Antibody

Sign In for Pricing
View Details
TGFBI (NM_000358) Human Over-expression Lysate
LC424775 20 µg

TGFBI (NM_000358) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS506785 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details