Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJECL16 (MJECL16)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJECL16 (MJECL16) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

Uncharacterized protein MJECL16

UniProt

Q60263

Expression Region

1-70

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSILISNKQFNHGLKDEFATKKDLELLEERILRYVDNKFNQLDKKIDRTFYLLVFFIILW VSREAFFYLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human apoprotein A5 (ApoA-5) ELISA Kit
YP-W12342-01 48 Tests

Human apoprotein A5 (ApoA-5) ELISA Kit

Sign In for Pricing
View Details
Human apoprotein A5 (ApoA-5) ELISA Kit
YP-W12342-02 96 Tests

Human apoprotein A5 (ApoA-5) ELISA Kit

Sign In for Pricing
View Details
Human Synuclein Alpha (SNCa) ELISA Kit
orb775676-01 48 Tests

Human Synuclein Alpha (SNCa) ELISA Kit

Sign In for Pricing
View Details
Human Synuclein Alpha (SNCa) ELISA Kit
orb775676-02 96 Tests

Human Synuclein Alpha (SNCa) ELISA Kit

Sign In for Pricing
View Details
2,2'- (2,5-Dimethoxy-1,4-phenylene) bis (4,4,5,5-tetramethyl-1,3,2-dioxaborolane)
JH920339 1 Each

2,2'- (2,5-Dimethoxy-1,4-phenylene) bis (4,4,5,5-tetramethyl-1,3,2-dioxaborolane)

Sign In for Pricing
View Details
Mouse matrix metalloproteinase 1 (MMP-1) ELISA Kit
201-02-0067 96 Tests

Mouse matrix metalloproteinase 1 (MMP-1) ELISA Kit

Sign In for Pricing
View Details