Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJECL16 (MJECL16)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJECL16 (MJECL16) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

Uncharacterized protein MJECL16

UniProt

Q60263

Expression Region

1-70

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSILISNKQFNHGLKDEFATKKDLELLEERILRYVDNKFNQLDKKIDRTFYLLVFFIILW VSREAFFYLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Met Antibody
CSB-PA047827 100 µL

Met Antibody

Sign In for Pricing
View Details
OKRC00242-96W - Cathepsin S ELISA Kit (Human)
OKRC00242-96W 96 Well

OKRC00242-96W - Cathepsin S ELISA Kit (Human)

Sign In for Pricing
View Details
PDXK Recombinant Protein (Mouse)
RP161201 100 µg

PDXK Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Mouse Monoclonal TdT Antibody (DNTT/1453) [DyLight 755]
NBP3-08563IR 100 µL

Mouse Monoclonal TdT Antibody (DNTT/1453) [DyLight 755]

Sign In for Pricing
View Details
2-Chloro-3-methoxybenzaldehyde
FC157379 100 g

2-Chloro-3-methoxybenzaldehyde

Sign In for Pricing
View Details
Neuron Specific Enolase (NSE)
MBS6489899-01 0.1 mL

Neuron Specific Enolase (NSE)

Sign In for Pricing
View Details