Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit c (atpE)

This Recombinant Staphylococcus aureus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q7A0C3

Expression Region

1-70

Origin

Staphylococcus aureus (strain MW2)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIG VVIAFMTFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPA2 Rabbit mAb
E51A08713 100 µL

HSPA2 Rabbit mAb

Sign In for Pricing
View Details
PYCR2 (NM_013328) Human Over-expression Lysate
LS029920-20ug 20 µg

PYCR2 (NM_013328) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-Human CSPG5 Polyclonal Antibody
HF786014-01 50 µg

Anti-Human CSPG5 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human CSPG5 Polyclonal Antibody
HF786014-02 100 µg

Anti-Human CSPG5 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Influenza A virus (H2N2) HA/Hemagglutinin Protein, C-His
orb3059358-01 50 µg

Recombinant Influenza A virus (H2N2) HA/Hemagglutinin Protein, C-His

Sign In for Pricing
View Details
Recombinant Influenza A virus (H2N2) HA/Hemagglutinin Protein, C-His
orb3059358-02 100 µg

Recombinant Influenza A virus (H2N2) HA/Hemagglutinin Protein, C-His

Sign In for Pricing
View Details