Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit c (atpE)

This Recombinant Staphylococcus aureus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q7A0C3

Expression Region

1-70

Origin

Staphylococcus aureus (strain MW2)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIG VVIAFMTFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCR/ABL/ASS tri color gene fusion probe reagent
FP-320 1 Vial 100 μL (10-20 T)

BCR/ABL/ASS tri color gene fusion probe reagent

Sign In for Pricing
View Details
IL34 siRNA (Human)
CRJ5472-01 15 nmol

IL34 siRNA (Human)

Sign In for Pricing
View Details
IL34 siRNA (Human)
CRJ5472-02 30 nmol

IL34 siRNA (Human)

Sign In for Pricing
View Details
DYDC1 Recombinant Protein Antigen
NBP1-88780PEP 0.1 mL

DYDC1 Recombinant Protein Antigen

Sign In for Pricing
View Details
EMD rabbit pAb
E28PN3900 100 µL

EMD rabbit pAb

Sign In for Pricing
View Details
Septin 11 Rabbit pAb
orb2712343-01 50 µL

Septin 11 Rabbit pAb

Sign In for Pricing
View Details