Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit c (atpE)

This Recombinant Staphylococcus aureus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q7A4E6

Expression Region

1-70

Origin

Staphylococcus aureus (strain N315)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIG VVIAFMTFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CP 85339
orb1986250-01 100 mg

CP 85339

Sign In for Pricing
View Details
CP 85339
orb1986250-02 500 mg

CP 85339

Sign In for Pricing
View Details
Compound Fr13435
Fr13435-01 100 mg

Compound Fr13435

Sign In for Pricing
View Details
Compound Fr13435
Fr13435-02 5 mg

Compound Fr13435

Sign In for Pricing
View Details
Compound Fr13435
Fr13435-03 25 mg

Compound Fr13435

Sign In for Pricing
View Details
Sheep Transforming growth factor β1 (TGF-β1) ELISA Kit
orb1656421-01 48 Tests

Sheep Transforming growth factor β1 (TGF-β1) ELISA Kit

Sign In for Pricing
View Details