Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit c (atpE)

This Recombinant Staphylococcus aureus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q6GEW7

Expression Region

1-70

Origin

Staphylococcus aureus (strain MRSA252)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIG VVIAFMTFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Mouse TF (Tissue factor) ELISA Kit
E-UNEL-M0155-01 5x 96 Tests

Uncoated Mouse TF (Tissue factor) ELISA Kit

Sign In for Pricing
View Details
Uncoated Mouse TF (Tissue factor) ELISA Kit
E-UNEL-M0155-02 15x 96 Tests

Uncoated Mouse TF (Tissue factor) ELISA Kit

Sign In for Pricing
View Details
MDM2 (MDM2/2414), CF488A conjugate, 0.1mg/mL
BNC882414-100 1x 100 µL

MDM2 (MDM2/2414), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymidylate Synthase (TMS715), CF740 conjugate, 0.1mg/mL
BNC740715-100 1x 100 µL

Thymidylate Synthase (TMS715), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Golgi Complex (AE-6), CF568 conjugate, 0.1mg/mL
BNC680868-100 1x 100 µL

Golgi Complex (AE-6), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Accuris Taq Polymerase, 1000 units
PR1000-1000 1 Each

Accuris Taq Polymerase, 1000 units

Sign In for Pricing
View Details