Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis ATP synthase subunit c (atpE)

This Recombinant Staphylococcus epidermidis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q8CNJ2

Expression Region

1-70

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIG VVIAFMTFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VEGFR2 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-43012R-BF350 100 µL

VEGFR2 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Anti-MYCBP Antibody Picoband®, HRP Conjugate
A06216-2-HRP 100 µg/Vial

Anti-MYCBP Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
LSM5 Double Nickase Plasmid (h2)
sc-409858-NIC-2 20 µg

LSM5 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Sheep Ly6/PLAUR domain containing protein 2 (LYPD2) ELISA Kit
GTR10313122 96 Well

Sheep Ly6/PLAUR domain containing protein 2 (LYPD2) ELISA Kit

Sign In for Pricing
View Details
Lycoperdic acid
UCA08672 100 mg

Lycoperdic acid

Sign In for Pricing
View Details
IDUA Rabbit Polyclonal Antibody (Biotin)
orb2584993 100 µg

IDUA Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details