Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis ATP synthase subunit c (atpE)

This Recombinant Staphylococcus epidermidis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q8CNJ2

Expression Region

1-70

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIG VVIAFMTFAG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Leptin, recombinant (Mouse) - Cy3 Labeled
FC3-003-13 1 nmol

Leptin, recombinant (Mouse) - Cy3 Labeled

Sign In for Pricing
View Details
Ataxin 3 Rabbit Polyclonal Antibody (AP)
orb948974 100 µL

Ataxin 3 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
GFAP (Astrocyte & Neural Stem Cell Marker) ; Clone GFAP/2076
RA0641-C1 1 mL

GFAP (Astrocyte & Neural Stem Cell Marker) ; Clone GFAP/2076

Sign In for Pricing
View Details
Rabbit Uricase (UOX) ELISA Kit
abx257564 96 Well

Rabbit Uricase (UOX) ELISA Kit

Sign In for Pricing
View Details
Saphir Bst2.0 Turbo GreenMaster, L pack
JBS-PCR-393L 10x 1.25 mL

Saphir Bst2.0 Turbo GreenMaster, L pack

Sign In for Pricing
View Details
ARHGAP11A sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
12278111 3x 1.0 µg

ARHGAP11A sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details