Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis ATP synthase subunit c (atpE)

This Recombinant Staphylococcus epidermidis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q8CNJ2

Expression Region

1-70

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIG VVIAFMTFAG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIX6 Rabbit Polyclonal Antibody
E10G06707 100 µL

SIX6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Hsa-miR-548aj-3p miRNA Mimic
orb1877472-01 5 nmol

Hsa-miR-548aj-3p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-548aj-3p miRNA Mimic
orb1877472-02 10 nmol

Hsa-miR-548aj-3p miRNA Mimic

Sign In for Pricing
View Details
Anti-Human CD16 Monoclonal Antibody (PerCP Conjugated)
MBS4516553-01 20 Tests

Anti-Human CD16 Monoclonal Antibody (PerCP Conjugated)

Sign In for Pricing
View Details
Anti-Human CD16 Monoclonal Antibody (PerCP Conjugated)
MBS4516553-02 50 Tests

Anti-Human CD16 Monoclonal Antibody (PerCP Conjugated)

Sign In for Pricing
View Details
Anti-Human CD16 Monoclonal Antibody (PerCP Conjugated)
MBS4516553-03 100 Tests

Anti-Human CD16 Monoclonal Antibody (PerCP Conjugated)

Sign In for Pricing
View Details