Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit c (atpE)

This Recombinant Staphylococcus aureus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q99SF0

Expression Region

1-70

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIG VVIAFMTFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNASE1L1 CRISPR Activation Plasmid (m2)
sc-427436-ACT-2 20 µg

DNASE1L1 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Mouse Padi3 (NM_011060) AAV Particle
MR219342A1V 250 µL

Mouse Padi3 (NM_011060) AAV Particle

Sign In for Pricing
View Details
SC61B Polyclonal Antibody
E44H08729 100 µL

SC61B Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal Stathmin 1 Antibody (STMN1/9227R) [DyLight 405]
NBP3-26964V 0.1 mL

Rabbit Monoclonal Stathmin 1 Antibody (STMN1/9227R) [DyLight 405]

Sign In for Pricing
View Details
MLX Peptide
orb2020337 100 µg

MLX Peptide

Sign In for Pricing
View Details
STF-118804
orb1300559-01 5 mg

STF-118804

Sign In for Pricing
View Details