Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit c (atpE)

This Recombinant Staphylococcus aureus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q99SF0

Expression Region

1-70

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIG VVIAFMTFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HighQC™ Induced Pluripotent Stem Cell, From Schizophrenia
ABC-SC0231 1 Vial

HighQC™ Induced Pluripotent Stem Cell, From Schizophrenia

Sign In for Pricing
View Details
Lano/LRRC1 Rabbit Polyclonal Antibody (BF594)
orb2493360 100 µL

Lano/LRRC1 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Human Glucokinase (GCK) ELISA Kit
DLR-GCK-Hu-96T 96 Tests

Human Glucokinase (GCK) ELISA Kit

Sign In for Pricing
View Details
CCR9 Recombinant Antibody, HRP Conjugated
bsm-61106R-HRP-TR 20 µL

CCR9 Recombinant Antibody, HRP Conjugated

Sign In for Pricing
View Details
KCND3-AS1 ORF Vector (Human) (pORF)
ORF022111 1.0 µg DNA

KCND3-AS1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Anti-PCBP1 Antibody Picoband® Fluoro594 Conjugated
A02636-1-Fluoro594 100 µg/Vial

Anti-PCBP1 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details