Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus ATP synthase subunit c (atpE)

This Recombinant Staphylococcus aureus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q99SF0

Expression Region

1-70

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIG VVIAFMTFAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc5a2-set siRNA/shRNA/RNAi Lentivector (Mouse)
44235094 4x 500 ng

Slc5a2-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
PNMA5 Polyclonal Antibody
A55331-050 50 µL

PNMA5 Polyclonal Antibody

Sign In for Pricing
View Details
NBEAL2 (NM_015175) Human Over-expression Lysate
LH09510V 100 µg

NBEAL2 (NM_015175) Human Over-expression Lysate

Sign In for Pricing
View Details
Rabbit lipoprotein-associated phospholipase A2, Lp-PL-A2 ELISA Kit
GA-E0129RB-01 48 Tests

Rabbit lipoprotein-associated phospholipase A2, Lp-PL-A2 ELISA Kit

Sign In for Pricing
View Details
Rabbit lipoprotein-associated phospholipase A2, Lp-PL-A2 ELISA Kit
GA-E0129RB-02 96 Tests

Rabbit lipoprotein-associated phospholipase A2, Lp-PL-A2 ELISA Kit

Sign In for Pricing
View Details
Mouse ARL13A siRNA
abx908102-01 15 nmol

Mouse ARL13A siRNA

Sign In for Pricing
View Details