Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pediococcus pentosaceus ATP synthase subunit c (atpE)

This Recombinant Pediococcus pentosaceus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q03EK9

Expression Region

1-70

Origin

Pediococcus pentosaceus (strain ATCC 25745 / 183-1w)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGAIAAGIAMFGAAIGGGIGDGIVVAKMLEGMARQPELSGQLRTTMFIGVGLVEAMPILA FVISLLVMNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BRCA1 (Breast Marker) (BRCA1/1472), CF488A conjugate, 0.1mg/mL
BNC881472-500 1x 500 µL

BRCA1 (Breast Marker) (BRCA1/1472), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-Descyano,-4-Carboxy-Finerenone
TRC-D938280-10MG 10 mg

4-Descyano,-4-Carboxy-Finerenone

Sign In for Pricing
View Details
Filaggrin (Keratinocyte Differentiation Marker) (FLG/1563), CF640R conjugate, 0.1mg/mL
BNC401563-500 1x 500 µL

Filaggrin (Keratinocyte Differentiation Marker) (FLG/1563), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Benchtop Low Speed Centrifuge BCBL-305
BCBL-305 1 Unit

Benchtop Low Speed Centrifuge BCBL-305

Sign In for Pricing
View Details
N-Acetyl-3-[(3-amino-3-oxopropyl)sulfinyl]-L-alanine Sodium Salt-d3
TRC-A168149-2.5MG 2.5 mg

N-Acetyl-3-[(3-amino-3-oxopropyl)sulfinyl]-L-alanine Sodium Salt-d3

Sign In for Pricing
View Details
Human MFSD8 activation kit by CRISPRa
GA116864 1 Kit

Human MFSD8 activation kit by CRISPRa

Sign In for Pricing
View Details