Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pediococcus pentosaceus ATP synthase subunit c (atpE)

This Recombinant Pediococcus pentosaceus ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q03EK9

Expression Region

1-70

Origin

Pediococcus pentosaceus (strain ATCC 25745 / 183-1w)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGAIAAGIAMFGAAIGGGIGDGIVVAKMLEGMARQPELSGQLRTTMFIGVGLVEAMPILA FVISLLVMNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENaC beta Antibody: ATTO 390
SMC-241D-A390 100 µg

ENaC beta Antibody: ATTO 390

Sign In for Pricing
View Details
Human USE1 activation kit by CRISPRa
GA111018 1 Kit

Human USE1 activation kit by CRISPRa

Sign In for Pricing
View Details
GST Goat Polyclonal Antibody
AB9919-500 1.5 mg

GST Goat Polyclonal Antibody

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD329 Antibody[K8]
AN00319J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD329 Antibody[K8]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD329 Antibody[K8]
AN00319J-02 100 Tests

PerCP/Cyanine5.5 Anti-Human CD329 Antibody[K8]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD329 Antibody[K8]
AN00319J-03 2x 100 Tests

PerCP/Cyanine5.5 Anti-Human CD329 Antibody[K8]

Sign In for Pricing
View Details