Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oenococcus oeni ATP synthase subunit c (atpE)

This Recombinant Oenococcus oeni ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q04G25

Expression Region

1-70

Origin

Oenococcus oeni (strain ATCC BAA-331 / PSU-1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNYIAAGIALCGSAIGAGIGNGMLMAKLIESIARQPELEGNLRTNMFISMALVEAMPIIV IAMSFVLINE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMA1 Rabbit Monoclonal Antibody [Clone ID: 24GB1610]
TA425157 100 µL

PSMA1 Rabbit Monoclonal Antibody [Clone ID: 24GB1610]

Sign In for Pricing
View Details
CF®790 Succinimidyl Ester
#92155 1x 250 nmol

CF®790 Succinimidyl Ester

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL
BNC400040-100 1x 100 µL

CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human OR52B4 activation kit by CRISPRa
GA115460 1 Kit

Human OR52B4 activation kit by CRISPRa

Sign In for Pricing
View Details
PCSK9 Human Gene Knockout Kit (CRISPR)
KN220000RB 1 Kit

PCSK9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NM23A (NME1) Rabbit Monoclonal Antibody
TA423730 100 µL

NM23A (NME1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details