Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus megaterium ATP synthase subunit c (atpE)

This Recombinant Bacillus megaterium ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P20603

Expression Region

1-70

Origin

Bacillus megaterium (strain ATCC 12872 / QMB1551)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLIASAIAIGLAALGAGIGNGLIVSKTIEGTARQPEARGTLTSMMFVGVALVEALPIIA VVIAFMVQGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBX4 (N-term) Rabbit Polyclonal Antibody
AP12233PU-N 400 µL

CBX4 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Elastatinal
TRC-E501008-2.5MG 2.5 mg

Elastatinal

Sign In for Pricing
View Details
AACT Antibody
KC-1936-01 50 μL

AACT Antibody

Sign In for Pricing
View Details
AACT Antibody
KC-1936-02 100 µL

AACT Antibody

Sign In for Pricing
View Details
AACT Antibody
KC-1936-03 1 mL

AACT Antibody

Sign In for Pricing
View Details
1,3-Dicyclohexyl-2-phenyl-pseudourea
TRC-D689065-500MG 500 mg

1,3-Dicyclohexyl-2-phenyl-pseudourea

Sign In for Pricing
View Details