Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus megaterium ATP synthase subunit c (atpE)

This Recombinant Bacillus megaterium ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P20603

Expression Region

1-70

Origin

Bacillus megaterium (strain ATCC 12872 / QMB1551)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLIASAIAIGLAALGAGIGNGLIVSKTIEGTARQPEARGTLTSMMFVGVALVEALPIIA VVIAFMVQGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Peroxiredoxin 6 (PRDX6) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4D1]
TA813653BM 100 µL

Peroxiredoxin 6 (PRDX6) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4D1]

Sign In for Pricing
View Details
FGF21 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F8]
TA502868AM 100 µL

FGF21 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F8]

Sign In for Pricing
View Details
Retinol Binding Protein-1 (G4E4), CF568 conjugate, 0.1mg/mL
BNC680855-100 1x 100 µL

Retinol Binding Protein-1 (G4E4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Diphenyl Sulfide
TRC-D491980-50G 50 g

Diphenyl Sulfide

Sign In for Pricing
View Details
CKB Mouse Monoclonal Antibody [Clone ID: 24GB7005]
TA425367 100 µL

CKB Mouse Monoclonal Antibody [Clone ID: 24GB7005]

Sign In for Pricing
View Details
Uncoated Human EGF (Epidermal Growth Factor) ELISA Kit
E-UNEL-H0040-01 5x 96 Tests

Uncoated Human EGF (Epidermal Growth Factor) ELISA Kit

Sign In for Pricing
View Details