Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus megaterium ATP synthase subunit c (atpE)

This Recombinant Bacillus megaterium ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-70.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

P20603

Expression Region

1-70

Origin

Bacillus megaterium (strain ATCC 12872 / QMB1551)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLIASAIAIGLAALGAGIGNGLIVSKTIEGTARQPEARGTLTSMMFVGVALVEALPIIA VVIAFMVQGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hieff NGS™ RNA Lib Prep Primer Mix for MGI
13334ES96 96 Tests

Hieff NGS™ RNA Lib Prep Primer Mix for MGI

Sign In for Pricing
View Details
PNMT Mouse Monoclonal Antibody [Clone ID: AT1C11]
AM39002PU-S 50 µL

PNMT Mouse Monoclonal Antibody [Clone ID: AT1C11]

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS626735 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
NEURL1 Antibody
8C16904-AAT 50 µg

NEURL1 Antibody

Sign In for Pricing
View Details
Desktop Multi frequency type Ultrasonic Cleaner BULC-202
BULC-202 Each

Desktop Multi frequency type Ultrasonic Cleaner BULC-202

Sign In for Pricing
View Details
Mouse IL-1 alpha Recombinant Rabbit monoclonal Antibody
HA723529 100 µL

Mouse IL-1 alpha Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details